| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IL-36Ra/IL-1F5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IL-36Ra/IL-1F5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-36Ra/IL-1F5. This antibody reacts with human. The IL-36Ra/IL-1F5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IL1F5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGA |
|---|
| Other Names | FIL1, FIL1 delta, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta), FIL1DIL-1 delta, IL1F5 (Canonical product IL-1F5a), IL-1RP3, IL36RA, IL-36RA, interleukin 1 family, member 5 (delta), interleukin 1, delta, Interleukin 36 Receptor Antagonist, interleukin-1 family member 5, Interleukin-1 HY1, Interleukin-1 receptor antagonist homolog 1, Interleukin-1-like protein 1, Interleukin-36 Receptor Antagonist |
|---|
| Gene, Accession # | IL36RN, Gene ID: 26525 |
|---|
| Catalog # | NBP1-83894 |
|---|
| Price | |
|---|
| Order / More Info | IL-36Ra/IL-1F5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23268368 |
|---|
| 产品资料 |
|
|