| 产品详情 |
| Edit |   |
| Antigenic Specificity | PPM1H |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PPM1H Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPM1H. This antibody reacts with human. The PPM1H Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPM1H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKETRR |
| Other Names | ARHCL1, FLJ13253, KIAA1157, member C like 1, NERPP-2C, neurite extension-related protein phosphatase related to PP2C, protein phosphatase 1H, protein phosphatase 1H (PP2C domain containing), protein phosphatase, Mg2+/Mn2+ dependent, 1H, URCC2 |
| Gene, Accession # | PPM1H, Gene ID: 57460, Accession: Q9ULR3, SwissProt: Q9ULR3 |
| Catalog # | NBP2-38859 |
| Price | |
| Order / More Info | PPM1H Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|