| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPM1J |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPM1J Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPM1J. This antibody reacts with human. The PPM1J Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPM1J antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPND HSRYTALAQALVLGARGTPRDRGWRLPNNKLGSGD |
|---|
| Other Names | DKFZp434P1514, FLJ35951, MGC19531, MGC90149, PP2CZ, PP2Czeta, PP2C-zeta, PPP2CZEC 3.1.3.16, protein phosphatase 1J, protein phosphatase 1J (PP2C domain containing), protein phosphatase 2a, catalytic subunit, zeta isoform, Protein phosphatase 2C isoform zeta, protein phosphatase 2C zeta, protein phosphatase, Mg2+/Mn2+ dependent, 1J |
|---|
| Gene, Accession # | PPM1J, Gene ID: 333926 |
|---|
| Catalog # | NBP2-13797 |
|---|
| Price | |
|---|
| Order / More Info | PPM1J Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|