| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPM1K |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPM1K Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPM1K. This antibody reacts with human. The PPM1K Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PPM1K antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PETKRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFS |
|---|
| Other Names | DKFZp667B084, DKFZp761G058, mitochondrial, PP2C domain-containing protein phosphatase 1K, PP2Ckappa, PP2C-like mitochondrial protein, PP2Cm, PP2C-type mitochondrial phosphoprotein phosphatase, protein phosphatase 2C kappa, protein phosphatase, Mg2+/Mn2+ dependent, 1K, PTMPEC 3.1.3.16 |
|---|
| Gene, Accession # | PPM1K, Gene ID: 152926 |
|---|
| Catalog # | NBP1-85035 |
|---|
| Price | |
|---|
| Order / More Info | PPM1K Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|
| 产品资料 |
|
|