| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HINFP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HINFP Antibody from Novus Biologicals is a rabbit polyclonal antibody to HINFP. This antibody reacts with human. The HINFP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HINFP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLNESSLQGIILETVPGEPGRKE |
|---|
| Other Names | HiNF-PDKFZP434F162, histone H4 gene-specific protein HiNF-P, histone H4 transcription factor, Histone nuclear factor P, MBD2 (methyl-CpG-binding protein)-interacting zinc finger protein, MBD2-interacting zinc finger 1, MBD2-interacting zinc finger protein, Methyl-CpG-binding protein 2-interacting zinc finger protein, MIZFDKFZp434F162, ZNF743MBD2-interacting zinc finger |
|---|
| Gene, Accession # | HINFP, Gene ID: 25988 |
|---|
| Catalog # | NBP2-32582 |
|---|
| Price | |
|---|
| Order / More Info | HINFP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|