| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PEX14 |
|---|
| Clone | 1G12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PEX14 Antibody (1G12) from Novus Biologicals is a mouse monoclonal antibody to PEX14. This antibody reacts with human. The PEX14 Antibody (1G12) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | PEX14 (NP_004556.1 293 a.a. - 375 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDVSHVDEEDCLGVQREDRRGGDGQINEQVEKLRRPEGASNESE |
|---|
| Other Names | dJ734G22.2, MGC12767, NAPP2, NF-E2 associated polypeptide 2, peroxin-14, peroxisomal biogenesis factor 14, Peroxisomal membrane anchor protein PEX14, peroxisomal membrane anchor protein Pex14p, peroxisomal membrane protein PEX14, Pex14p, PTS1 receptor docking protein, PTS1 receptor-docking protein |
|---|
| Gene, Accession # | PEX14, Gene ID: 5195, Accession: NP_004556, SwissProt: NP_004556 |
|---|
| Catalog # | H00005195-M01 |
|---|
| Price | |
|---|
| Order / More Info | PEX14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|