| Edit |   |
| Antigenic Specificity | VEST1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The VEST1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VEST1. This antibody reacts with human. The VEST1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C8ORF34 The peptide sequence was selected from the N terminal of C8ORF34. Peptide sequence MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK. |
| Other Names | C8orf34, chromosome 8 open reading frame 34, VEST-1 |
| Gene, Accession # | C8orf34, Gene ID: 116328 |
| Catalog # | NBP1-70756 |
| Price | |
| Order / More Info | VEST1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |