| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VE-Statin/EGFL7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VE-Statin/EGFL7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VE-Statin/EGFL7. This antibody reacts with human. The VE-Statin/EGFL7 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RGDTCQSGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKD |
|---|
| Other Names | EGF-like protein 7, EGF-like-domain, multiple 7, epidermal growth factor-like protein 7, MEGF7, MGC111117, Multiple EGF-like domains protein 7, Multiple epidermal growth factor-like domains protein 7, NEU1 protein, NOTCH4-like protein, RP11-251M1.2, Vascular endothelial statin, VE-STATIN, Zneu1 |
|---|
| Gene, Accession # | EGFL7, Gene ID: 51162 |
|---|
| Catalog # | NBP2-68693 |
|---|
| Price | |
|---|
| Order / More Info | VE-Statin/EGFL7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|