| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Bone marrow stromal cell antigen 1/CD157 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Bone marrow stromal cell antigen 1/CD157 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Bone marrow stromal cell antigen 1/CD157. This antibody reacts with human. The Bone marrow stromal cell antigen 1/CD157 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Bone marrow stromal cell antigen 1/CD157 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVL PSDYDLFINLSRHSIPRDKSLFWE |
|---|
| Other Names | ADP-ribosyl cyclase 2, Bone marrow stromal antigen 1, bone marrow stromal cell antigen 1, BST-1, cADPr hydrolase 2, CD157, CD157 antigen, Cyclic ADP-ribose hydrolase 2, EC 3.2.2.5, NAD(+) nucleosidase |
|---|
| Gene, Accession # | BST1, Gene ID: 683 |
|---|
| Catalog # | NBP2-14363 |
|---|
| Price | |
|---|
| Order / More Info | Bone marrow stromal cell antigen 1/CD157 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28731711 |
|---|
| 产品资料 |
|
|