| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Melanoma Antigen Family B5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Melanoma Antigen Family B5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Melanoma Antigen Family B5. This antibody reacts with human. The Melanoma Antigen Family B5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Melanoma Antigen Family B5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLY |
|---|
| Other Names | Cancer/Testis Antigen 3.3, Cancer/Testis Antigen Family 3, Cancer/Testis Antigen Family 3, Member 3, CT3.3, MAGE Family Testis And Tumor-Specific Protein, MAGEB5, MAGE-B5, MAGE-B5 Antigen, Melanoma-Associated Antigen B5, Member 3 |
|---|
| Gene, Accession # | MAGEB5, Gene ID: 347541, Accession: Q9BZ81, SwissProt: Q9BZ81 |
|---|
| Catalog # | NBP2-30617 |
|---|
| Price | |
|---|
| Order / More Info | Melanoma Antigen Family B5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|