| Edit |   |
| Antigenic Specificity | FAM101A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM101A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM101A. This antibody reacts with human. The FAM101A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human FAM101AThe immunogen for this antibody is FAM101A. Peptide sequence QLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQ. |
| Other Names | family with sequence similarity 101, member A, FLJ44614 |
| Gene, Accession # | FAM101A, Gene ID: 144347, Accession: EAW98447, SwissProt: EAW98447 |
| Catalog # | NBP1-79528 |
| Price | |
| Order / More Info | FAM101A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |