| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OXSM |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OXSM Antibody from Novus Biologicals is a rabbit polyclonal antibody to OXSM. This antibody reacts with human. The OXSM Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human OXSM antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL |
|---|
| Other Names | 3-ketoacyl-acyl carrier protein synthase, 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial, 3-oxoacyl-ACP synthase, mitochondrial, acyl-malonyl acyl carrier protein-condensing enzyme, beta-ketoacyl synthase, Beta-ketoacyl-ACP synthase, EC 2.3.1, EC 2.3.1.41, FASN2D, FLJ20604, KASI, KS3-oxoacyl-acyl-carrier-protein synthase, type II mitochondrial beta-ketoacyl synthase |
|---|
| Gene, Accession # | OXSM, Gene ID: 54995 |
|---|
| Catalog # | NBP1-84730 |
|---|
| Price | |
|---|
| Order / More Info | OXSM Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|