| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | THRAP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The THRAP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to THRAP3. This antibody reacts with human. The THRAP3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human THRAP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RGKRSEGGHRGFVPEKNFRVTAYKAVQEKSSSPPPRKTSESRDKLGAKGDFPTGKSSFSITREAQVNVRMDSFDEDLARPSGL |
|---|
| Other Names | FLJ22082, MGC133082, MGC133083, thyroid hormone receptor associated protein 3, Thyroid hormone receptor-associated protein complex 150 kDa component, thyroid hormone receptor-associated protein, 150 kDa subunit, Trap150, TRAP150thyroid hormone receptor-associated protein 3 |
|---|
| Gene, Accession # | THRAP3, Gene ID: 9967 |
|---|
| Catalog # | NBP2-57174 |
|---|
| Price | |
|---|
| Order / More Info | THRAP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|