| 产品详情 |
| Edit |   |
| Antigenic Specificity | ABCC9 |
| Clone | S319A-14 |
| Host Species | Mouse |
| Reactive Species | mouse, rat |
| Isotype | IgG2a |
| Format | Protein G purified |
| Size | 0.025 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. 1 ug/ml of SUR2A Antibody was sufficient for detection of SUR2A in 20 ug of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary Antibody. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ABCC9 Antibody (S319A-14) from Novus Biologicals is a mouse monoclonal antibody to ABCC9. This antibody reacts with mouse, rat. The ABCC9 Antibody (S319A-14) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
| Immunogen | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Other Names | ABC37, ATP-binding cassette, sub-family C (CFTR/MRP), member 9, CMD1OATP-binding cassette transporter sub-family C member 9, EC 3.6.3.44, FLJ36852, Sulfonylurea receptor 2, sulfonylurea receptor 2A, SUR2ATP-binding cassette sub-family C member 9 |
| Gene, Accession # | ABCC9, Gene ID: 10060, Accession: P70170 |
| Catalog # | NBP2-22403-0.025mg |
| Price | |
| Order / More Info | ABCC9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 30074836 |
| 产品资料 |
|
|