| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABCE1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ABCE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCE1. This antibody reacts with human. The ABCE1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ABCE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINP |
|---|
| Other Names | 2'-5'-oligoadenylate-binding protein, ATP-binding cassette, sub-family E (OABP), member 1, HuHP68, OABP, Ribonuclease 4 inhibitor, ribonuclease L (2'-5'-oligoisoadenylate synthetase-dependent) inhibitor, RLIABC38, RNase L inhibitor, RNASEL1, RNASELIRNS4IATP-binding cassette sub-family E member 1 |
|---|
| Gene, Accession # | ABCE1, Gene ID: 6059 |
|---|
| Catalog # | NBP2-58061 |
|---|
| Price | |
|---|
| Order / More Info | ABCE1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|