| 产品详情 |
| Edit |   |
| Antigenic Specificity | ABCF2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ABCF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCF2. This antibody reacts with human, mouse, rat. The ABCF2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat ABCF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQD |
| Other Names | ABC28, ABC-type transport protein, ATP-binding cassette sub-family F member 2, ATP-binding cassette, sub-family F (GCN20), member 2, DKFZp586K1823, EC 3.6.3, EC 3.6.3.17, EST133090, HUSSY18, HUSSY-18, Iron inhibited ABC transporter 2, Iron-inhibited ABC transporter 2, M-ABC1 |
| Gene, Accession # | ABCF2, Gene ID: 10061, Accession: Q9UG63, SwissProt: Q9UG63 |
| Catalog # | NBP1-89316 |
| Price | |
| Order / More Info | ABCF2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|