| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABCG1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ABCG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCG1. This antibody reacts with human. The ABCG1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ABCG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEG |
|---|
| Other Names | ABC transporter 8, ABC8ATP-binding cassette sub-family G member 1, ATP-binding cassette transporter 8, ATP-binding cassette, sub-family G (WHITE), member 1, homolog of Drosophila white, MGC34313, White protein homolog, white protein homolog (ATP-binding cassette transporter 8), 10ATP-binding cassette transporter member 1 of subfamily G, WHITE1, WHT1 |
|---|
| Gene, Accession # | ABCG1, Gene ID: 9619 |
|---|
| Catalog # | NBP2-54681 |
|---|
| Price | |
|---|
| Order / More Info | ABCG1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|