| 产品详情 |
| Edit |   |
| Antigenic Specificity | OVCA1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The OVCA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OVCA1. This antibody reacts with human. The OVCA1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
| Immunogen | Synthetic peptides corresponding to DPH1(DPH1 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of DPH1. Peptide sequence RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFV. |
| Other Names | Diphthamide biosynthesis protein 2 homolog-like 1, Diphthamide biosynthesis protein 2-like, diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1(S. cerevisiae), DPH1 homolog, DPH1 homolog (S. cerevisiae), DPH2L, DPH2L1diphthamide biosynthesis protein 1, DPH2-like 1, DPH-like 1, DPH-like 1 (S. cerevisiae), FLJ33211, hsDph1, Ovarian cancer-associated gene 1 protein, ovarian tumor suppressor candidate 1, OVCA1candidate tumor suppressor in ovarian cancer 1 |
| Gene, Accession # | DPH1, Gene ID: 1801, Accession: Q9BZG8, SwissProt: Q9BZG8 |
| Catalog # | NBP1-56693 |
| Price | |
| Order / More Info | OVCA1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|