| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Peroxiredoxin 6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Peroxiredoxin 6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Peroxiredoxin 6. This antibody reacts with human. The Peroxiredoxin 6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to PRDX6(peroxiredoxin 6) The peptide sequence was selected from the C terminal of PRDX6. Peptide sequence VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP. |
|---|
| Other Names | 1-Cys, 24 kDa protein, Acidic calcium-independent phospholipase A2, aiPLA21-Cys PRX, Antioxidant protein 2, AOP2Non-selenium glutathione peroxidase, EC 1.11.1.15, EC 1.11.1.7, EC 3.1.1.-, KIAA0106Red blood cells page spot 12, Liver 2D page spot 40, MGC46173, NSGPx1-Cys peroxiredoxin, p29, peroxiredoxin 6, peroxiredoxin-6, PRX |
|---|
| Gene, Accession # | PRDX6, Gene ID: 9588, Accession: P30041, SwissProt: P30041 |
|---|
| Catalog # | NBP1-55160 |
|---|
| Price | |
|---|
| Order / More Info | Peroxiredoxin 6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|