| Edit |   |
|---|
| Antigenic Specificity | Peroxiredoxin Like 2C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Peroxiredoxin Like 2C Antibody from Novus Biologicals is a rabbit polyclonal antibody to Peroxiredoxin Like 2C. This antibody reacts with human. The Peroxiredoxin Like 2C Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human C9orf21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQ |
|---|
| Other Names | AhpC/TSA antioxidant enzyme domain containing 1, C9orf21, chromosome 9 open reading frame 21, hypothetical protein LOC195827 |
|---|
| Gene, Accession # | AAED1, Gene ID: 195827 |
|---|
| Catalog # | NBP1-91073 |
|---|
| Price | |
|---|
| Order / More Info | Peroxiredoxin Like 2C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|