| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PERP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PERP Antibody from Novus Biologicals is a rabbit polyclonal antibody to PERP. This antibody reacts with human. The PERP Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PERP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW |
|---|
| Other Names | dJ496H19.1, KCP1KCP-1, Keratinocyte-associated protein 1, KRTCAP11110017A08Rik, p53 apoptosis effector related to PMP22, p53 apoptosis effector related to PMP-22, P53-induced protein PIGPC1, PERP, TP53 apoptosis effector, PIGPC1RP3-496H19.1, THWkeratinocytes associated protein 1, Transmembrane protein THW |
|---|
| Gene, Accession # | PERP, Gene ID: 64065 |
|---|
| Catalog # | NBP1-85173 |
|---|
| Price | |
|---|
| Order / More Info | PERP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|