| 产品详情 |
| Edit |   |
| Antigenic Specificity | CYP4F2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 22798501). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CYP4F2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYP4F2. This antibody reacts with human. The CYP4F2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CYP4F2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD |
| Other Names | CPF2, CYPIVF2, Cytochrome P450 4F2, cytochrome P450, family 4, subfamily F, polypeptide 2, cytochrome P450, subfamily IVF, polypeptide 2, Cytochrome P450-LTB-omega, EC 1.14.13.30, leukotriene B4 omega-hydroxylase, Leukotriene-B(4) 20-monooxygenase 1, leukotriene-B(4) omega-hydroxylase 1, leukotriene-B4 20-monooxygenase |
| Gene, Accession # | CYP4F2, Gene ID: 8529 |
| Catalog # | NBP1-86461 |
| Price | |
| Order / More Info | CYP4F2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 22798501 |
| 产品资料 |
|
|