| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CYP4F3 |
|---|
| Clone | 4E11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CYP4F3 Antibody (4E11) from Novus Biologicals is a mouse monoclonal antibody to CYP4F3. This antibody reacts with human. The CYP4F3 Antibody (4E11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CYP4F3 (NP_000887, 100 a.a. - 198 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLM |
|---|
| Other Names | CYP4F, CYPIVF3, cytochrome P-450, Cytochrome P450 4F3, cytochrome P450, family 4, subfamily F, polypeptide 3, cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omegahydroxylase), Cytochrome P450-LTB-omega, EC 1.14.13.30, leukotriene B4 omega hydroxylase, Leukotriene-B(4) 20-monooxygenase 2, leukotriene-B(4) omega-hydroxylase 2, leukotriene-B4 20-monooxygenase, LTB4HCPF3 |
|---|
| Gene, Accession # | CYP4F3, Gene ID: 4051, Accession: NP_000887, SwissProt: NP_000887 |
|---|
| Catalog # | H00004051-M01 |
|---|
| Price | |
|---|
| Order / More Info | CYP4F3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|