| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CYP4F3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CYP4F3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYP4F3. This antibody reacts with human. The CYP4F3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | Synthetic peptides corresponding to CYP4F3(cytochrome P450, family 4, subfamily F, polypeptide 3) The peptide sequence was selected from the N terminal of CYP4F3. Peptide sequence LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF. |
|---|
| Other Names | CYP4F, CYPIVF3, cytochrome P-450, Cytochrome P450 4F3, cytochrome P450, family 4, subfamily F, polypeptide 3, cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omegahydroxylase), Cytochrome P450-LTB-omega, EC 1.14.13.30, leukotriene B4 omega hydroxylase, Leukotriene-B(4) 20-monooxygenase 2, leukotriene-B(4) omega-hydroxylase 2, leukotriene-B4 20-monooxygenase, LTB4HCPF3 |
|---|
| Gene, Accession # | CYP4F3, Gene ID: 4051, Accession: Q08477, SwissProt: Q08477 |
|---|
| Catalog # | NBP1-69678 |
|---|
| Price | |
|---|
| Order / More Info | CYP4F3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|