| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CYP2S1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CYP2S1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYP2S1. This antibody reacts with human. The CYP2S1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CYP2S1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL |
|---|
| Other Names | CYPIIS1, cytochrome P450 2S1, cytochrome P450 family member predicted from ESTs, cytochrome P450, family 2, subfamily S, polypeptide 1, cytochrome P450, subfamily IIS, polypeptide 1, cytochrome P540, subfamily IIS, polypeptide 1, EC 1.14.14.1 |
|---|
| Gene, Accession # | CYP2S1, Gene ID: 29785 |
|---|
| Catalog # | NBP2-55469 |
|---|
| Price | |
|---|
| Order / More Info | CYP2S1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|