| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATOH8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATOH8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATOH8. This antibody reacts with human. The ATOH8 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ATOH8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPVPVPVPVPVPYGAPHR |
|---|
| Other Names | ATH6, atonal homolog 6, atonal homolog 8 (Drosophila), basic helix-loop-helix transcription factor 6, BHLHA21, bHLHa21basic helix loop helix transcription factor 6, Class A basic helix-loop-helix protein 21, FLJ14708, FLJ38730, hATH6, Helix-loop-helix protein hATH-6, protein atonal homolog 8 |
|---|
| Gene, Accession # | ATOH8, Gene ID: 84913 |
|---|
| Catalog # | NBP2-55037 |
|---|
| Price | |
|---|
| Order / More Info | ATOH8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|