| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATOX1 |
|---|
| Clone | 2E6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against tissue lysate, cell lysate and recombinant protein for WB. It has been used for IF and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATOX1 Antibody (2E6) from Novus Biologicals is a mouse monoclonal antibody to ATOX1. This antibody reacts with human. The ATOX1 Antibody (2E6) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | ATOX1 (NP_004036, 1 a.a. - 68 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE |
|---|
| Other Names | ATX1, ATX1 (antioxidant protein 1, yeast) homolog 1, ATX1 antioxidant protein 1 homolog (yeast), copper transport protein ATOX1, hah1, HAH1 MGC138453, Metal transport protein ATX1, MGC138455 |
|---|
| Gene, Accession # | ATOX1, Gene ID: 475, Accession: NP_004036, SwissProt: NP_004036 |
|---|
| Catalog # | H00000475-M01 |
|---|
| Price | |
|---|
| Order / More Info | ATOX1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23076575 |
|---|
| 产品资料 |
|
|