| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP13A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP13A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP13A1. This antibody reacts with human. The ATP13A1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ATP13A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YDPSKATFVKVVPTPNNGSTELVALHRNEGEDGLEVLSFEFQKIKYSYDALEKKQFLPVAFPVGNAFSYYQSNRGFQEDSEIRAAEKKFGSNK |
|---|
| Other Names | ATP13A, ATPase type 13A, ATPase type 13A1, cation transporting ATPase, CGI-152, DKFZp761L1623, EC 3.6.3, EC 3.6.3.-, EC 3.6.3.12, FLJ31858, FLJ41786, FLJ43873, KIAA1825FLJ90317, probable cation-transporting ATPase 13A1 |
|---|
| Gene, Accession # | ATP13A1, Gene ID: 57130, Accession: Q9HD20, SwissProt: Q9HD20 |
|---|
| Catalog # | NBP2-30651 |
|---|
| Price | |
|---|
| Order / More Info | ATP13A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|