| Edit |   |
|---|
| Antigenic Specificity | KIAA0408 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KIAA0408 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIAA0408. This antibody reacts with human. The KIAA0408 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DWRPSNLSGRPRSADPRSNYGVVEKLLKTYETATESALQNSKCFQDNWTKCNSDVSGGATLSQHLEMLQMEQQFQQKTAVWGGQEVKQGI |
|---|
| Other Names | FLJ43995, hypothetical protein LOC9729, KIAA0408, RP3-403A15.2 |
|---|
| Gene, Accession # | KIAA0408, Gene ID: 9729 |
|---|
| Catalog # | NBP2-68705 |
|---|
| Price | |
|---|
| Order / More Info | KIAA0408 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|