| 产品详情 |
| Edit |   |
| Antigenic Specificity | LMP7/PSMB8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | Protein A purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LMP7/PSMB8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LMP7/PSMB8. This antibody reacts with human, mouse. The LMP7/PSMB8 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | PSMB8 (NP_004150.1, 1 a.a. - 272 a.a.) full-length human protein. MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ |
| Other Names | beta5i, D6S216E, EC 3.4.25.1, LMP7MGC1491, Low molecular mass protein 7, low molecular weight protein 7, Macropain subunit C13, Multicatalytic endopeptidase complex subunit C13, protease component C13, proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalpeptidase 7), proteasome catalytic subunit 3i, Proteasome component C13, proteasome subunit beta 5i, proteasome subunit beta type-8, Proteasome subunit beta-5i, proteasome subunit Y2, proteasome-related gene 7, PSMB5iD6S216, Really interesting new gene 10 protein, RING10proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalprotease 7), Y2 |
| Gene, Accession # | PSMB8, Gene ID: 5696, Accession: NP_004150.1, SwissProt: NP_004150.1 |
| Catalog # | H00005696-D01P |
| Price | |
| Order / More Info | LMP7/PSMB8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|