| Edit |   |
| Antigenic Specificity | RAP1GAP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RAP1GAP Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAP1GAP. This antibody reacts with human. The RAP1GAP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptides corresponding to RAP1GAP(RAP1 GTPase activating protein) The peptide sequence was selected from the middle region of RAP1GAP. Peptide sequence IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA. |
| Other Names | GTPase activating protein 1, RAP1 GTPase activating protein |
| Gene, Accession # | RAP1GAP, Gene ID: 5909, Accession: P47736, SwissProt: P47736 |
| Catalog # | NBP1-53072-20ul |
| Price | |
| Order / More Info | RAP1GAP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |