| Edit |   |
|---|
| Antigenic Specificity | RAP1GAP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RAP1GAP Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAP1GAP. This antibody reacts with human. The RAP1GAP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to RAP1GAP(RAP1 GTPase activating protein) The peptide sequence was selected from the middle region of RAP1GAP. Peptide sequence IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA. |
|---|
| Other Names | GTPase activating protein 1, RAP1 GTPase activating protein |
|---|
| Gene, Accession # | RAP1GAP, Gene ID: 5909, Accession: P47736, SwissProt: P47736 |
|---|
| Catalog # | NBP1-53072 |
|---|
| Price | |
|---|
| Order / More Info | RAP1GAP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|