| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EIF2G |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EIF2G Antibody from Novus Biologicals is a rabbit polyclonal antibody to EIF2G. This antibody reacts with human. The EIF2G Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: 3 |
|---|
| Immunogen | Synthetic peptides corresponding to EIF2G (eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa) The peptide sequence was selected from the N terminal of EIF2G. Peptide sequence LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCP |
|---|
| Other Names | EIF2, eIF-2gA, EIF2gamma, eIF-2-gamma X, EIF2Geukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD), eIF-2gX, eukaryotic translation initiation factor 2 subunit 3, Eukaryotic translation initiation factor 2 subunit gamma X, eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa, eukaryotic translation initiation factor 2G |
|---|
| Gene, Accession # | EIF2S3, Gene ID: 1968, Accession: P41091, SwissProt: P41091 |
|---|
| Catalog # | NBP1-53087 |
|---|
| Price | |
|---|
| Order / More Info | EIF2G Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|