| 产品详情 |
| Edit |   |
| Antigenic Specificity | EIF2G |
| Clone | 2C9 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EIF2G Antibody (2C9) from Novus Biologicals is a mouse monoclonal antibody to EIF2G. This antibody reacts with human. The EIF2G Antibody (2C9) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | EIF2S3 (NP_001406 383 a.a. - 472 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD |
| Other Names | EIF2, eIF-2gA, EIF2gamma, eIF-2-gamma X, EIF2Geukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD), eIF-2gX, eukaryotic translation initiation factor 2 subunit 3, Eukaryotic translation initiation factor 2 subunit gamma X, eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa, eukaryotic translation initiation factor 2G |
| Gene, Accession # | EIF2S3, Gene ID: 1968, Accession: NP_001406, SwissProt: NP_001406 |
| Catalog # | H00001968-M01 |
| Price | |
| Order / More Info | EIF2G Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|