| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EIF3G |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EIF3G Antibody from Novus Biologicals is a rabbit polyclonal antibody to EIF3G. This antibody reacts with human. The EIF3G Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human EIF3G antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPN |
|---|
| Other Names | eIF3 p42, eIF3 p44, eIF-3-delta, eIF3-delta, eIF3g, EIF3-P42, eIF3-p44, EIF3S4eIF-3 RNA-binding subunit, Eukaryotic translation initiation factor 3 RNA-binding subunit, Eukaryotic translation initiation factor 3 subunit 4, eukaryotic translation initiation factor 3 subunit G, eukaryotic translation initiation factor 3 subunit p42, eukaryotic translation initiation factor 3, subunit 4 (delta, 44kD), eukaryotic translation initiation factor 3, subunit 4 delta, 44kDa, eukaryotic translation initiation factor 3, subunit G |
|---|
| Gene, Accession # | EIF3G, Gene ID: 8666 |
|---|
| Catalog # | NBP1-84872 |
|---|
| Price | |
|---|
| Order / More Info | EIF3G Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|