| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | eIF4G1 |
|---|
| Clone | 2A9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The eIF4G1 Antibody (2A9) from Novus Biologicals is a mouse monoclonal antibody to eIF4G1. This antibody reacts with human, mouse, rat. The eIF4G1 Antibody (2A9) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | EIF4G1 (NP_886553 1500 a.a. - 1599 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN |
|---|
| Other Names | DKFZp686A1451, EIF4F, eIF-4G 1, EIF-4G1, EIF4-gamma, eIF-4-gamma 1, EIF4GI, EIF4Gp220, eucaryotic translation initiation factor 4G, eukaryotic translation initiation factor 4 gamma 1, eukaryotic translation initiation factor 4 gamma, 1, P220 |
|---|
| Gene, Accession # | EIF4G1, Gene ID: 1981, Accession: NP_886553, SwissProt: NP_886553 |
|---|
| Catalog # | H00001981-M10 |
|---|
| Price | |
|---|
| Order / More Info | eIF4G1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|