| Edit |   |
| Antigenic Specificity | Gm527 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Gm527 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Gm527. This antibody reacts with mouse. The Gm527 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the C terminal of Gm527. Immunizing peptide sequence: CHGAPPFVVLNMQHWKPEDLAYVPYYLDLSDHKYLLEGATLFNKEEHHYS. |
| Other Names | hypothetical protein LOC217648, MGC117765, predicted gene 527 |
| Gene, Accession # | Gm527, Gene ID: 217648, Accession: Q4KL13 |
| Catalog # | NBP1-74246 |
| Price | |
| Order / More Info | Gm527 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |