| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RUNX1/CBFA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RUNX1/CBFA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RUNX1/CBFA2. This antibody reacts with human. The RUNX1/CBFA2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RUNX1/CBFA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN |
|---|
| Other Names | Acute myeloid leukemia 1 protein, AML1acute myeloid leukemia 1, AML1-EVI-1, CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1, Core-binding factor subunit alpha-2, EVI-1, PEBP2A2, runt domain, alpha subunit 2, runt-related transcription factor 1, SL3/AKV core-binding factor alpha B subunit |
|---|
| Gene, Accession # | RUNX1, Gene ID: 861 |
|---|
| Catalog # | NBP2-55213 |
|---|
| Price | |
|---|
| Order / More Info | RUNX1/CBFA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|