| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RUNX3/CBFA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RUNX3/CBFA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RUNX3/CBFA3. This antibody reacts with human. The RUNX3/CBFA3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RUNX3/CBFA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNP |
|---|
| Other Names | Acute myeloid leukemia 2 protein, AML2SL3/AKV core-binding factor alpha C subunit, CBFA3MGC16070, CBF-alpha-3, PEA2 alpha C, PEA2-alpha C, PEBP2 alpha C, PEBP2A3FLJ34510, PEBP2-alpha C, runt domain, alpha subunit 3, runt-related transcription factor 3, SL3-3 enhancer factor 1 alpha C subunit, transcription factor AML2 |
|---|
| Gene, Accession # | RUNX3, Gene ID: 864, Accession: Q13761, SwissProt: Q13761 |
|---|
| Catalog # | NBP2-38863 |
|---|
| Price | |
|---|
| Order / More Info | RUNX3/CBFA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|