| Edit |   |
|---|
| Antigenic Specificity | PRELID2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRELID2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRELID2. This antibody reacts with human. The PRELID2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PRELID2(PRELI domain containing 2) The peptide sequence was selected from the C terminal of PRELID2. Peptide sequence GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE. |
|---|
| Other Names | FLJ38376, MGC21644, PRELI domain containing 2, PRELI domain-containing protein 2 |
|---|
| Gene, Accession # | PRELID2, Gene ID: 153768, Accession: Q8N945, SwissProt: Q8N945 |
|---|
| Catalog # | NBP1-56751-20ul |
|---|
| Price | |
|---|
| Order / More Info | PRELID2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|