| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | pre-mRNA cleavage factor I (59 kDa subunit) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The pre-mRNA cleavage factor I (59 kDa subunit) Antibody from Novus Biologicals is a rabbit polyclonal antibody to pre-mRNA cleavage factor I (59 kDa subunit). This antibody reacts with human, mouse, rat. The pre-mRNA cleavage factor I (59 kDa subunit) Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat pre-mRNA cleavage factor I (59 kDa subunit) antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA |
|---|
| Other Names | CFIm59, cleavage and polyadenylation specific factor 7, 59kDa, CPSF 59 kDa subunit, FLJ12529,59 kDa subunit, FLJ39024, MGC9315, pre-mRNA cleavage factor I, 59 kDa subunit |
|---|
| Gene, Accession # | CPSF7, Gene ID: 79869 |
|---|
| Catalog # | NBP1-89868 |
|---|
| Price | |
|---|
| Order / More Info | pre-mRNA cleavage factor I (59 kDa subunit) Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|