| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPM1D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPM1D Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPM1D. This antibody reacts with human. The PPM1D Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPM1D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLT |
|---|
| Other Names | EC 3.1.3.16, p53-induced protein phosphatase 1, PP2C-delta, protein phosphatase 1D, protein phosphatase 1D magnesium-dependent, delta isoform, protein phosphatase 2C delta isoform, Protein phosphatase 2C isoform delta, Protein phosphatase magnesium-dependent 1 delta, protein phosphatase, Mg2+/Mn2+ dependent, 1D, wild-type p53-induced phosphatase 1, Wip1, WIP1protein phosphatase Wip1 |
|---|
| Gene, Accession # | PPM1D, Gene ID: 8493 |
|---|
| Catalog # | NBP1-87249 |
|---|
| Price | |
|---|
| Order / More Info | PPM1D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|