| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPM1E |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPM1E Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPM1E. This antibody reacts with human. The PPM1E Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PPM1E antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLE |
|---|
| Other Names | ca(2+)/calmodulin-dependent protein kinase phosphatase N, CAMKN, CaMKP-N, caMKP-nucleus, DKFZp781F1422, KIAA1072, nuclear calmodulin-dependent protein kinase phosphatase, partner of PIX 1, partner of PIXA, partner of PIX-alpha, POPX1, PP2CH, protein phosphatase 1E, protein phosphatase 1E (PP2C domain containing), protein phosphatase, Mg2+/Mn2+ dependent, 1E |
|---|
| Gene, Accession # | PPM1E, Gene ID: 22843 |
|---|
| Catalog # | NBP1-86650 |
|---|
| Price | |
|---|
| Order / More Info | PPM1E Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|