| Edit |   |
| Antigenic Specificity | FAM116A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM116A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM116A. This antibody reacts with human. The FAM116A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FAM116A(family with sequence similarity 116, member A) The peptide sequence was selected from the middle region of FAM116A. Peptide sequence KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSF. |
| Other Names | family with sequence similarity 116, member A, FLJ34969, hypothetical protein LOC201627 |
| Gene, Accession # | DENND6A, Gene ID: 201627, Accession: Q8IWF6, SwissProt: Q8IWF6 |
| Catalog # | NBP1-56753 |
| Price | |
| Order / More Info | FAM116A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |