| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | 5-HT3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The 5-HT3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to 5-HT3A. This antibody reacts with human. The 5-HT3A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEI |
|---|
| Other Names | 5-HT-3,5-HT3-A, 5-HT3R5-hydroxytryptamine receptor 3A, 5-hydroxytryptamine (serotonin) receptor 3A, 5-hydroxytryptamine receptor 3,5-HT3A5HT3R, HTR35HT3 serotonin receptor, Serotonin receptor 3A, Serotonin-gated ion channel receptor |
|---|
| Gene, Accession # | HTR3A, Gene ID: 3359 |
|---|
| Catalog # | NBP2-68884 |
|---|
| Price | |
|---|
| Order / More Info | 5-HT3A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|