| Edit |   |
|---|
| Antigenic Specificity | 5-HT5A |
|---|
| Clone | 10D3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The 5-HT5A Antibody (10D3) from Novus Biologicals is a mouse monoclonal antibody to 5-HT5A. This antibody reacts with human. The 5-HT5A Antibody (10D3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | HTR5A (NP_076917 223 a.a. - 282 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR |
|---|
| Other Names | 5-HT-5A, 5-HT5A5-hydroxytryptamine receptor 5A, 5-hydroxytryptamine (serotonin) receptor 5A, MGC138226,5-HT-5, Serotonin receptor 5A |
|---|
| Gene, Accession # | HTR5A, Gene ID: 3361, Accession: NP_076917, SwissProt: NP_076917 |
|---|
| Catalog # | H00003361-M01 |
|---|
| Price | |
|---|
| Order / More Info | 5-HT5A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|