| Edit |   |
|---|
| Antigenic Specificity | 5-HT1E |
|---|
| Clone | 2E9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The 5-HT1E Antibody (2E9) from Novus Biologicals is a mouse monoclonal antibody to 5-HT1E. This antibody reacts with human. The 5-HT1E Antibody (2E9) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | HTR1E (NP_000856.1 206 a.a. - 276 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG |
|---|
| Other Names | 5-HT-1E, 5-hydroxytryptamine (serotonin) receptor 1E, S31,5-HT1E5-hydroxytryptamine receptor 1E, Serotonin receptor 1E |
|---|
| Gene, Accession # | HTR1E, Gene ID: 3354, Accession: NP_000856, SwissProt: NP_000856 |
|---|
| Catalog # | H00003354-M03 |
|---|
| Price | |
|---|
| Order / More Info | 5-HT1E Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22260342 |
|---|