| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | 5-HT3E |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The 5-HT3E Antibody from Novus Biologicals is a rabbit polyclonal antibody to 5-HT3E. This antibody reacts with human. The 5-HT3E Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human 5-HT3E antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LAFILSRATPRPALGPLSYREHRVALLHLTHSMSTTGRGVTFTINCSGF |
|---|
| Other Names | 5-HT3 receptor subunit E splice variant HTR3Ea, 5-HT3c1,5-HT3E, 5-hydroxytryptamine (serotonin) receptor 3, family member E, 5-hydroxytryptamine receptor 3E, MGC120035, MGC120036, serotonin receptor 3E |
|---|
| Gene, Accession # | HTR3E, Gene ID: 285242, Accession: A5X5Y0, SwissProt: A5X5Y0 |
|---|
| Catalog # | NBP2-33578 |
|---|
| Price | |
|---|
| Order / More Info | 5-HT3E Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|