| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Troponin T Type 2 (cardiac) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Troponin T Type 2 (cardiac) Antibody from Novus Biologicals is a rabbit polyclonal antibody to Troponin T Type 2 (cardiac). This antibody reacts with human. The Troponin T Type 2 (cardiac) Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Troponin T Type 2 (cardiac) antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IEEVVEEYEEEEQEEAAVEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLV |
|---|
| Other Names | cardiac, CMD1D, CMPD2, dilated 1D (autosomal dominant), hypertrophic 2, MGC3889, RCM3, TnTc, troponin T type 2 (cardiac), troponin T, cardiac muscle |
|---|
| Gene, Accession # | TNNT2, Gene ID: 7139 |
|---|
| Catalog # | NBP1-88069 |
|---|
| Price | |
|---|
| Order / More Info | Troponin T Type 2 (cardiac) Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|