| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HIF-3 alpha |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HIF-3 alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to HIF-3 alpha. This antibody reacts with human. The HIF-3 alpha Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HIF-3 alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD |
|---|
| Other Names | Basic-helix-loop-helix-PAS protein MOP7, BHLHE17, bHLHe17HIF-3A2, Class E basic helix-loop-helix protein 17, HIF-3A4, HIF-3-alpha, HIF3-alpha, hypoxia inducible factor 3, alpha subunit, hypoxia-inducible factor 3-alpha, hypoxia-inducible factor-3 alpha 4, Inhibitory PAS domain protein, IPASHIF3-alpha-1, Member of PAS protein 7, MOP7PAS domain-containing protein 7, PASD7HIF-3A |
|---|
| Gene, Accession # | HIF3A, Gene ID: 64344, Accession: Q9Y2N7, SwissProt: Q9Y2N7 |
|---|
| Catalog # | NBP1-89977 |
|---|
| Price | |
|---|
| Order / More Info | HIF-3 alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|